Lineage for d2b42b_ (2b42 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051304Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2051349Protein Xylanase II [49979] (19 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2051372Species Bacillus circulans [TaxId:1397] [49980] (21 PDB entries)
  8. 2051398Domain d2b42b_: 2b42 B: [127815]
    Other proteins in same PDB: d2b42a1
    automated match to d1xnba_

Details for d2b42b_

PDB Entry: 2b42 (more details), 2.5 Å

PDB Description: crystal structure of the triticum xylanse inhibitor-i in complex with bacillus subtilis xylanase
PDB Compounds: (B:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d2b42b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b42b_ b.29.1.11 (B:) Xylanase II {Bacillus circulans [TaxId: 1397]}
stdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwapn
gngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidgd
rttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgssn
vtvw

SCOPe Domain Coordinates for d2b42b_:

Click to download the PDB-style file with coordinates for d2b42b_.
(The format of our PDB-style files is described here.)

Timeline for d2b42b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2b42a1