Lineage for d2b42b1 (2b42 B:2-185)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 664069Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 664114Protein Xylanase II [49979] (16 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 664135Species Bacillus circulans [TaxId:1397] [49980] (10 PDB entries)
  8. 664145Domain d2b42b1: 2b42 B:2-185 [127815]
    automatically matched to d1bvv__

Details for d2b42b1

PDB Entry: 2b42 (more details), 2.5 Å

PDB Description: crystal structure of the triticum xylanse inhibitor-i in complex with bacillus subtilis xylanase
PDB Compounds: (B:) Endo-1,4-beta-xylanase A

SCOP Domain Sequences for d2b42b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b42b1 b.29.1.11 (B:2-185) Xylanase II {Bacillus circulans [TaxId: 1397]}
stdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwapn
gngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidgd
rttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgssn
vtvw

SCOP Domain Coordinates for d2b42b1:

Click to download the PDB-style file with coordinates for d2b42b1.
(The format of our PDB-style files is described here.)

Timeline for d2b42b1: