SCOPe 2.08: Domain d2b42b_: 2b42 B:

Lineage for d2b42b_ (2b42 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (21 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus circulans [TaxId:1397] [49980] (21 PDB entries)

8. Domain d2b42b_: 2b42 B: [127815]
   Other proteins in same PDB: d2b42a1
   automated match to d1xnba_

Details for d2b42b_

PDB Entry: 2b42, 2.5 Å

PDB Description: crystal structure of the triticum xylanse inhibitor-i in complex with bacillus subtilis xylanase

PDB Compounds: (B:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d2b42b_:

Sequence; same for both SEQRES and ATOM records:

>d2b42b_ b.29.1.11 (B:) Xylanase II {Bacillus circulans [TaxId: 1397]}
stdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwapn
gngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidgd
rttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgssn
vtvw

Timeline for d2b42b_:

• d2b42b_ first appeared in SCOP 1.73, called d2b42b1
  
• d2b42b_ appears in SCOPe 2.07