SCOPe 2.07: Domain d2b3zc2: 2b3z C:1-145

Lineage for d2b3zc2 (2b3z C:1-145)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
   strand 5 is parallel to strand 4

6. Protein Riboflavin biosynthesis protein RibD [142837] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [142838] (4 PDB entries)
   Uniprot P17618 1-145

8. Domain d2b3zc2: 2b3z C:1-145 [127812]
   Other proteins in same PDB: d2b3za1, d2b3zb1, d2b3zc1, d2b3zd1, d2b3zd3
   automated match to d2b3za2
   complexed with zn

Details for d2b3zc2

PDB Entry: 2b3z, 2.41 Å

PDB Description: crystal structure of a bifunctional deaminase and reductase involved in riboflavin biosynthesis

PDB Compounds: (C:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d2b3zc2:

Sequence; same for both SEQRES and ATOM records:

>d2b3zc2 c.97.1.2 (C:1-145) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
meeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygeahaevhaihmaga
haegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvagrgismmkeagie
vregiladqaerlnekflhfmrtgl

Timeline for d2b3zc2:

• d2b3zc2 first appeared in SCOP 1.73
  
• d2b3zc2 appears in SCOPe 2.06
  
• d2b3zc2 appears in the current release, SCOPe 2.08