Lineage for d2b3zc2 (2b3z C:1-145)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166092Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2166093Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2166168Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
    strand 5 is parallel to strand 4
  6. 2166219Protein Riboflavin biosynthesis protein RibD [142837] (2 species)
  7. 2166220Species Bacillus subtilis [TaxId:1423] [142838] (4 PDB entries)
    Uniprot P17618 1-145
  8. 2166223Domain d2b3zc2: 2b3z C:1-145 [127812]
    Other proteins in same PDB: d2b3za1, d2b3zb1, d2b3zc1, d2b3zd1, d2b3zd3
    automated match to d2b3za2
    complexed with zn

Details for d2b3zc2

PDB Entry: 2b3z (more details), 2.41 Å

PDB Description: crystal structure of a bifunctional deaminase and reductase involved in riboflavin biosynthesis
PDB Compounds: (C:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d2b3zc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b3zc2 c.97.1.2 (C:1-145) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
meeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygeahaevhaihmaga
haegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvagrgismmkeagie
vregiladqaerlnekflhfmrtgl

SCOPe Domain Coordinates for d2b3zc2:

Click to download the PDB-style file with coordinates for d2b3zc2.
(The format of our PDB-style files is described here.)

Timeline for d2b3zc2: