Lineage for d2b3zc1 (2b3z C:146-359)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843142Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 843143Superfamily c.71.1: Dihydrofolate reductase-like [53597] (2 families) (S)
  5. 843333Family c.71.1.2: RibD C-terminal domain-like [142701] (2 proteins)
    Pfam PF01872
  6. 843342Protein Riboflavin biosynthesis protein RibD [142702] (2 species)
  7. 843343Species Bacillus subtilis [TaxId:1423] [142703] (2 PDB entries)
    Uniprot P17618 146-359
  8. 843346Domain d2b3zc1: 2b3z C:146-359 [127811]
    Other proteins in same PDB: d2b3za2, d2b3zb2, d2b3zc2, d2b3zd2
    automatically matched to 2B3Z A:146-359
    complexed with zn

Details for d2b3zc1

PDB Entry: 2b3z (more details), 2.41 Å

PDB Description: crystal structure of a bifunctional deaminase and reductase involved in riboflavin biosynthesis
PDB Compounds: (C:) Riboflavin biosynthesis protein ribD

SCOP Domain Sequences for d2b3zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b3zc1 c.71.1.2 (C:146-359) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
pyvtlkaaasldgkiatstgdskwitseaarqdaqqyrkthqsilvgvgtvkadnpsltc
rlpnvtkqpvrvildtvlsipedakvicdqiaptwifttaradeekkkrlsafgvniftl
eteriqipdvlkilaeegimsvyveggsavhgsfvkegcfqeiifyfapkliggthapsl
isgegfqsmkdvpllqftditqigrdikltakpt

SCOP Domain Coordinates for d2b3zc1:

Click to download the PDB-style file with coordinates for d2b3zc1.
(The format of our PDB-style files is described here.)

Timeline for d2b3zc1: