SCOPe 2.07: Domain d2b3zb1: 2b3z B:146-359

Lineage for d2b3zb1 (2b3z B:146-359)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.2: RibD C-terminal domain-like [142701] (3 proteins)
   Pfam PF01872

6. Protein Riboflavin biosynthesis protein RibD [142702] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [142703] (4 PDB entries)
   Uniprot P17618 146-359

8. Domain d2b3zb1: 2b3z B:146-359 [127809]
   Other proteins in same PDB: d2b3za2, d2b3zb2, d2b3zc2, d2b3zd2, d2b3zd3
   automated match to d2b3za1
   complexed with zn

Details for d2b3zb1

PDB Entry: 2b3z, 2.41 Å

PDB Description: crystal structure of a bifunctional deaminase and reductase involved in riboflavin biosynthesis

PDB Compounds: (B:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d2b3zb1:

Sequence; same for both SEQRES and ATOM records:

>d2b3zb1 c.71.1.2 (B:146-359) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
pyvtlkaaasldgkiatstgdskwitseaarqdaqqyrkthqsilvgvgtvkadnpsltc
rlpnvtkqpvrvildtvlsipedakvicdqiaptwifttaradeekkkrlsafgvniftl
eteriqipdvlkilaeegimsvyveggsavhgsfvkegcfqeiifyfapkliggthapsl
isgegfqsmkdvpllqftditqigrdikltakpt

Timeline for d2b3zb1:

• d2b3zb1 first appeared in SCOP 1.73
  
• d2b3zb1 appears in SCOPe 2.06
  
• d2b3zb1 appears in the current release, SCOPe 2.08