![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins) strand 5 is parallel to strand 4 |
![]() | Protein Riboflavin biosynthesis protein RibD [142837] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [142838] (4 PDB entries) Uniprot P17618 1-145 |
![]() | Domain d2b3za2: 2b3z A:1-145 [127808] Other proteins in same PDB: d2b3za1, d2b3zb1, d2b3zc1, d2b3zd1, d2b3zd3 complexed with zn |
PDB Entry: 2b3z (more details), 2.41 Å
SCOPe Domain Sequences for d2b3za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b3za2 c.97.1.2 (A:1-145) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]} meeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygeahaevhaihmaga haegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvagrgismmkeagie vregiladqaerlnekflhfmrtgl
Timeline for d2b3za2: