![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.2: RibD C-terminal domain-like [142701] (3 proteins) Pfam PF01872 |
![]() | Protein Riboflavin biosynthesis protein RibD [142702] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [142703] (2 PDB entries) Uniprot P17618 146-359 |
![]() | Domain d2b3za1: 2b3z A:146-359 [127807] Other proteins in same PDB: d2b3za2, d2b3zb2, d2b3zc2, d2b3zd2 complexed with zn |
PDB Entry: 2b3z (more details), 2.41 Å
SCOPe Domain Sequences for d2b3za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b3za1 c.71.1.2 (A:146-359) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]} pyvtlkaaasldgkiatstgdskwitseaarqdaqqyrkthqsilvgvgtvkadnpsltc rlpnvtkqpvrvildtvlsipedakvicdqiaptwifttaradeekkkrlsafgvniftl eteriqipdvlkilaeegimsvyveggsavhgsfvkegcfqeiifyfapkliggthapsl isgegfqsmkdvpllqftditqigrdikltakpt
Timeline for d2b3za1: