Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families) contains mixed beta-sheet barrel, closed n=7, S=10 |
Family c.8.2.1: LeuD-like [52017] (4 proteins) Pfam PF00694; permutation of the domain order in the proteins containing this family domain |
Protein ron-responsive element binding protein 1, C-terminal domain [141974] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141975] (2 PDB entries) Uniprot P21399 631-889 |
Domain d2b3yb1: 2b3y B:631-889 [127805] Other proteins in same PDB: d2b3ya2, d2b3yb2 automated match to d2b3xa1 complexed with act, fmt, gol, sf4 |
PDB Entry: 2b3y (more details), 1.85 Å
SCOPe Domain Sequences for d2b3yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b3yb1 c.8.2.1 (B:631-889) ron-responsive element binding protein 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} dklffwnskstyiksppffenltldlqppksivdayvllnlgdsvttdhispagniarns paaryltnrgltprefnsygsrrgndavmargtfanirllnrflnkqapqtihlpsgeil dvfdaaeryqqaglplivlagkeygagssrdwaakgpfllgikavlaesyerihrsnlvg mgvipleylpgenadalgltgqerytiiipenlkpqmkvqvkldtgktfqavmrfdtdve ltyflnggilnymirkmak
Timeline for d2b3yb1: