Lineage for d2b3yb1 (2b3y B:631-889)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 689773Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 689805Superfamily c.8.2: LeuD/IlvD-like [52016] (3 families) (S)
    contains mixed beta-sheet barrel, closed n=7, S=10
  5. 689806Family c.8.2.1: LeuD-like [52017] (4 proteins)
    Pfam PF00694; permutation of the domain order in the proteins containing this family domain
  6. 689833Protein ron-responsive element binding protein 1, C-terminal domain [141974] (1 species)
  7. 689834Species Human (Homo sapiens) [TaxId:9606] [141975] (2 PDB entries)
  8. 689836Domain d2b3yb1: 2b3y B:631-889 [127805]
    Other proteins in same PDB: d2b3ya2, d2b3yb2
    automatically matched to 2B3X A:631-889
    complexed with act, fmt, gol, sf4

Details for d2b3yb1

PDB Entry: 2b3y (more details), 1.85 Å

PDB Description: Structure of a monoclinic crystal form of human cytosolic aconitase (IRP1)
PDB Compounds: (B:) Iron-responsive element binding protein 1

SCOP Domain Sequences for d2b3yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b3yb1 c.8.2.1 (B:631-889) ron-responsive element binding protein 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dklffwnskstyiksppffenltldlqppksivdayvllnlgdsvttdhispagniarns
paaryltnrgltprefnsygsrrgndavmargtfanirllnrflnkqapqtihlpsgeil
dvfdaaeryqqaglplivlagkeygagssrdwaakgpfllgikavlaesyerihrsnlvg
mgvipleylpgenadalgltgqerytiiipenlkpqmkvqvkldtgktfqavmrfdtdve
ltyflnggilnymirkmak

SCOP Domain Coordinates for d2b3yb1:

Click to download the PDB-style file with coordinates for d2b3yb1.
(The format of our PDB-style files is described here.)

Timeline for d2b3yb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b3yb2