Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.83: Aconitase iron-sulfur domain [53731] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.83.1: Aconitase iron-sulfur domain [53732] (1 family) |
Family c.83.1.1: Aconitase iron-sulfur domain [53733] (3 proteins) duplication: consists of three structurally similar subdomains with subdomains 1 and 3 being related by pseudo twofold symmetry |
Protein Iron-responsive element binding protein 1, N-terminal domain [142758] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142759] (2 PDB entries) |
Domain d2b3ya2: 2b3y A:2-630 [127804] Other proteins in same PDB: d2b3ya1, d2b3yb1 automatically matched to 2B3X A:2-630 complexed with act, fmt, gol, sf4 |
PDB Entry: 2b3y (more details), 1.85 Å
SCOP Domain Sequences for d2b3ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b3ya2 c.83.1.1 (A:2-630) Iron-responsive element binding protein 1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} snpfahlaepldpvqpgkkffnlnkledsrygrlpfsirvlleaairncdeflvkkqdie nilhwnvtqhknievpfkparvilqdftgvpavvdfaamrdavkklggdpekinpvcpad lvidhsiqvdfnrradslqknqdlefernrerfeflkwgsqafhnmriippgsgiihqvn leylarvvfdqdgyyypdslvgtdshttmidglgilgwgvggieaeavmlgqpismvlpq vigyrlmgkphplvtstdivltitkhlrqvgvvgkfveffgpgvaqlsiadratianmcp eygataaffpvdevsitylvqtgrdeeklkyikkylqavgmfrdfndpsqdpdftqvvel dlktvvpccsgpkrpqdkvavsdmkkdfesclgakqgfkgfqvapehhndhktfiydnte ftlahgsvviaaitsctntsnpsvmlgagllakkavdaglnvmpyiktslspgsgvvtyy lqesgvmpylsqlgfdvvgygcmtcignsgplpepvveaitqgdlvavgvlsgnrnfegr vhpntranylaspplviayaiagtiridfekeplgvnakgqqvflkdiwptrdeiqaver qyvipgmfkevyqkietvneswnalatps
Timeline for d2b3ya2: