![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.2: LeuD/IlvD-like [52016] (3 families) ![]() contains mixed beta-sheet barrel, closed n=7, S=10 |
![]() | Family c.8.2.1: LeuD-like [52017] (4 proteins) Pfam PF00694; permutation of the domain order in the proteins containing this family domain |
![]() | Protein ron-responsive element binding protein 1, C-terminal domain [141974] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141975] (2 PDB entries) |
![]() | Domain d2b3ya1: 2b3y A:631-889 [127803] Other proteins in same PDB: d2b3ya2, d2b3yb2 automatically matched to 2B3X A:631-889 complexed with act, fmt, gol, sf4 |
PDB Entry: 2b3y (more details), 1.85 Å
SCOP Domain Sequences for d2b3ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b3ya1 c.8.2.1 (A:631-889) ron-responsive element binding protein 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} dklffwnskstyiksppffenltldlqppksivdayvllnlgdsvttdhispagniarns paaryltnrgltprefnsygsrrgndavmargtfanirllnrflnkqapqtihlpsgeil dvfdaaeryqqaglplivlagkeygagssrdwaakgpfllgikavlaesyerihrsnlvg mgvipleylpgenadalgltgqerytiiipenlkpqmkvqvkldtgktfqavmrfdtdve ltyflnggilnymirkmak
Timeline for d2b3ya1: