| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families) ![]() contains mixed beta-sheet barrel, closed n=7, S=10 |
| Family c.8.2.1: LeuD-like [52017] (4 proteins) Pfam PF00694; permutation of the domain order in the proteins containing this family domain |
| Protein ron-responsive element binding protein 1, C-terminal domain [141974] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [141975] (2 PDB entries) Uniprot P21399 631-889 |
| Domain d2b3xa1: 2b3x A:631-889 [127801] Other proteins in same PDB: d2b3xa2 complexed with edo, sf4, zn |
PDB Entry: 2b3x (more details), 2.54 Å
SCOPe Domain Sequences for d2b3xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b3xa1 c.8.2.1 (A:631-889) ron-responsive element binding protein 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dklffwnskstyiksppffenltldlqppksivdayvllnlgdsvttdhispagniarns
paaryltnrgltprefnsygsrrgndavmargtfanirllnrflnkqapqtihlpsgeil
dvfdaaeryqqaglplivlagkeygagssrdwaakgpfllgikavlaesyerihrsnlvg
mgvipleylpgenadalgltgqerytiiipenlkpqmkvqvkldtgktfqavmrfdtdve
ltyflnggilnymirkmak
Timeline for d2b3xa1: