SCOPe 2.08: Domain d2b3xa1: 2b3x A:631-889

Lineage for d2b3xa1 (2b3x A:631-889)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families)
   contains mixed beta-sheet barrel, closed n=7, S=10

5. Family c.8.2.1: LeuD-like [52017] (4 proteins)
   Pfam PF00694; permutation of the domain order in the proteins containing this family domain

6. Protein ron-responsive element binding protein 1, C-terminal domain [141974] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141975] (2 PDB entries)
   Uniprot P21399 631-889

8. Domain d2b3xa1: 2b3x A:631-889 [127801]
   Other proteins in same PDB: d2b3xa2
   complexed with edo, sf4, zn

Details for d2b3xa1

PDB Entry: 2b3x, 2.54 Å

PDB Description: structure of an orthorhombic crystal form of human cytosolic aconitase (irp1)

PDB Compounds: (A:) Iron-responsive element binding protein 1

SCOPe Domain Sequences for d2b3xa1:

Sequence; same for both SEQRES and ATOM records:

>d2b3xa1 c.8.2.1 (A:631-889) ron-responsive element binding protein 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dklffwnskstyiksppffenltldlqppksivdayvllnlgdsvttdhispagniarns
paaryltnrgltprefnsygsrrgndavmargtfanirllnrflnkqapqtihlpsgeil
dvfdaaeryqqaglplivlagkeygagssrdwaakgpfllgikavlaesyerihrsnlvg
mgvipleylpgenadalgltgqerytiiipenlkpqmkvqvkldtgktfqavmrfdtdve
ltyflnggilnymirkmak

Timeline for d2b3xa1:

• d2b3xa1 first appeared in SCOP 1.73
  
• d2b3xa1 appears in SCOPe 2.07