Lineage for d2b3wa1 (2b3w A:1-160)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741967Fold d.336: YbiA-like [143989] (1 superfamily)
    consists of six alpha-helices and two two-stranded beta-sheets
  4. 741968Superfamily d.336.1: YbiA-like [143990] (1 family) (S)
  5. 741969Family d.336.1.1: YbiA-like [143991] (1 protein)
  6. 741970Protein Hypothetical protein YbiA [143992] (1 species)
  7. 741971Species Escherichia coli [TaxId:562] [143993] (1 PDB entry)
  8. 741972Domain d2b3wa1: 2b3w A:1-160 [127800]

Details for d2b3wa1

PDB Entry: 2b3w (more details)

PDB Description: nmr structure of the e.coli protein ybia, northeast structural genomics target et24.
PDB Compounds: (A:) Hypothetical protein ybiA

SCOP Domain Sequences for d2b3wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b3wa1 d.336.1.1 (A:1-160) Hypothetical protein YbiA {Escherichia coli [TaxId: 562]}
mpvraqriqhvmqdtiinfystsddygdfsnfaawpikvdgktwptsehyfqaqkfldek
yreeirrvsspmvaarmgrdrskplrknwesvkeqvmrkalrakfeqhaelralllatap
aklvehtendaywgdgghgkgknrlgyllmelreqlaiek

SCOP Domain Coordinates for d2b3wa1:

Click to download the PDB-style file with coordinates for d2b3wa1.
(The format of our PDB-style files is described here.)

Timeline for d2b3wa1: