SCOPe 2.08: Domain d2b3wa1: 2b3w A:1-160

Lineage for d2b3wa1 (2b3w A:1-160)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.336: YbiA-like [143989] (1 superfamily)
   consists of six alpha-helices and two two-stranded beta-sheets

4. Superfamily d.336.1: YbiA-like [143990] (1 family)
   automatically mapped to Pfam PF08719

5. Family d.336.1.1: YbiA-like [143991] (1 protein)

6. Protein Hypothetical protein YbiA [143992] (1 species)

7. Species Escherichia coli [TaxId:562] [143993] (1 PDB entry)
   Uniprot P30176 1-160

8. Domain d2b3wa1: 2b3w A:1-160 [127800]
   Other proteins in same PDB: d2b3wa2

Details for d2b3wa1

PDB Entry: 2b3w

PDB Description: nmr structure of the e.coli protein ybia, northeast structural genomics target et24.

PDB Compounds: (A:) Hypothetical protein ybiA

SCOPe Domain Sequences for d2b3wa1:

Sequence; same for both SEQRES and ATOM records:

>d2b3wa1 d.336.1.1 (A:1-160) Hypothetical protein YbiA {Escherichia coli [TaxId: 562]}
mpvraqriqhvmqdtiinfystsddygdfsnfaawpikvdgktwptsehyfqaqkfldek
yreeirrvsspmvaarmgrdrskplrknwesvkeqvmrkalrakfeqhaelralllatap
aklvehtendaywgdgghgkgknrlgyllmelreqlaiek

Timeline for d2b3wa1:

• d2b3wa1 first appeared in SCOP 1.73
  
• d2b3wa1 appears in SCOPe 2.07