![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Diamine acetyltransferase 1 [143652] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143653] (8 PDB entries) Uniprot P21673 2-170! Uniprot P21673 3-169 |
![]() | Domain d2b3va_: 2b3v A: [127799] automated match to d2b3ua1 complexed with aco; mutant |
PDB Entry: 2b3v (more details), 1.95 Å
SCOPe Domain Sequences for d2b3va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b3va_ d.108.1.1 (A:) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} fvirpataadcsdilrlikelaryeymeeqviltekdlledgfgehpfyhclvaevpkeh wtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrcs smhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmate
Timeline for d2b3va_: