SCOPe 2.03: Domain d2b3ta1: 2b3t A:2-275

Lineage for d2b3ta1 (2b3t A:2-275)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.30: N5-glutamine methyltransferase, HemK [89743] (2 proteins)

6. Protein N5-glutamine methyltransferase, HemK [89744] (2 species)
   contains an N-terminal alpha helical subdomain; res. 13-84

7. Species Escherichia coli [TaxId:562] [110666] (2 PDB entries)
   Uniprot P37186

8. Domain d2b3ta1: 2b3t A:2-275 [127796]
   Other proteins in same PDB: d2b3tb1
   automatically matched to d1t43a_
   complexed with sah

Details for d2b3ta1

PDB Entry: 2b3t, 3.1 Å

PDB Description: structure of complex between e. coli translation termination factor rf1 and the prmc methyltransferase

PDB Compounds: (A:) Protein methyltransferase hemK

SCOPe Domain Sequences for d2b3ta1:

Sequence; same for both SEQRES and ATOM records:

>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]}
eyqhwlreaisqlqasesprrdaeillehvtgrgrtfilafgetqltdeqcqqldalltr
rrdgepiahltgvrefwslplfvspatliprpdteclveqalarlpeqpcrildlgtgtg
aialalaserpdceiiavdrmpdavslaqrnaqhlaiknihilqsdwfsalagqqfamiv
snppyideqdphlqqgdvrfepltalvaadsgmadivhiieqsrnalvsggflllehgwq
qgeavrqafilagyhdvetcrdygdnervtlgry

Timeline for d2b3ta1:

• d2b3ta1 first appeared in SCOP 1.73
  
• d2b3ta1 appears in SCOPe 2.02
  
• d2b3ta1 is called d2b3ta_ in SCOPe 2.04
  
• d2b3ta1 appears in the current release, SCOPe 2.08, called d2b3ta_