Lineage for d2b3ta1 (2b3t A:2-275)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704539Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 704540Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) (S)
  5. 705049Family c.66.1.30: N5-glutamine methyltransferase, HemK [89743] (1 protein)
  6. 705050Protein N5-glutamine methyltransferase, HemK [89744] (2 species)
    contains an N-terminal alpha helical subdomain; res. 13-84
  7. 705051Species Escherichia coli [TaxId:562] [110666] (2 PDB entries)
  8. 705052Domain d2b3ta1: 2b3t A:2-275 [127796]
    automatically matched to d1t43a_
    complexed with sah

Details for d2b3ta1

PDB Entry: 2b3t (more details), 3.1 Å

PDB Description: structure of complex between e. coli translation termination factor rf1 and the prmc methyltransferase
PDB Compounds: (A:) Protein methyltransferase hemK

SCOP Domain Sequences for d2b3ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]}
eyqhwlreaisqlqasesprrdaeillehvtgrgrtfilafgetqltdeqcqqldalltr
rrdgepiahltgvrefwslplfvspatliprpdteclveqalarlpeqpcrildlgtgtg
aialalaserpdceiiavdrmpdavslaqrnaqhlaiknihilqsdwfsalagqqfamiv
snppyideqdphlqqgdvrfepltalvaadsgmadivhiieqsrnalvsggflllehgwq
qgeavrqafilagyhdvetcrdygdnervtlgry

SCOP Domain Coordinates for d2b3ta1:

Click to download the PDB-style file with coordinates for d2b3ta1.
(The format of our PDB-style files is described here.)

Timeline for d2b3ta1: