Lineage for d2b3ta_ (2b3t A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468838Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2468839Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2469842Family c.66.1.30: N5-glutamine methyltransferase, HemK [89743] (2 proteins)
  6. 2469843Protein N5-glutamine methyltransferase, HemK [89744] (2 species)
    contains an N-terminal alpha helical subdomain; res. 13-84
  7. 2469844Species Escherichia coli [TaxId:562] [110666] (2 PDB entries)
    Uniprot P37186
  8. 2469845Domain d2b3ta_: 2b3t A: [127796]
    Other proteins in same PDB: d2b3tb1
    automated match to d2b3ta1
    complexed with sah

Details for d2b3ta_

PDB Entry: 2b3t (more details), 3.1 Å

PDB Description: structure of complex between e. coli translation termination factor rf1 and the prmc methyltransferase
PDB Compounds: (A:) Protein methyltransferase hemK

SCOPe Domain Sequences for d2b3ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b3ta_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]}
meyqhwlreaisqlqasesprrdaeillehvtgrgrtfilafgetqltdeqcqqldallt
rrrdgepiahltgvrefwslplfvspatliprpdteclveqalarlpeqpcrildlgtgt
gaialalaserpdceiiavdrmpdavslaqrnaqhlaiknihilqsdwfsalagqqfami
vsnppyideqdphlqqgdvrfepltalvaadsgmadivhiieqsrnalvsggflllehgw
qqgeavrqafilagyhdvetcrdygdnervtlgryy

SCOPe Domain Coordinates for d2b3ta_:

Click to download the PDB-style file with coordinates for d2b3ta_.
(The format of our PDB-style files is described here.)

Timeline for d2b3ta_: