SCOPe 2.06: Domain d2b3sb_: 2b3s B:

Lineage for d2b3sb_ (2b3s B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.13: DsbA-like [100953] (4 proteins)
   contains an all-alpha subdomain insertion

6. Protein automated matches [190208] (8 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [186961] (1 PDB entry)

8. Domain d2b3sb_: 2b3s B: [127795]
   automated match to d1a23__
   mutant

Details for d2b3sb_

PDB Entry: 2b3s, 1.96 Å

PDB Description: structure of the dsba mutant (p31g-c33a)

PDB Compounds: (B:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d2b3sb_:

Sequence; same for both SEQRES and ATOM records:

>d2b3sb_ c.47.1.13 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
qyedgkqyttlekpvagapqvleffsffcghayqfeevlhisdnvkkklpegvkmtkyhv
nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
ydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyadt
vkylsek

Timeline for d2b3sb_:

• d2b3sb_ first appeared in SCOP 1.73, called d2b3sb1
  
• d2b3sb_ appears in SCOPe 2.05
  
• d2b3sb_ appears in SCOPe 2.07
  
• d2b3sb_ appears in the current release, SCOPe 2.08