Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.13: DsbA-like [100953] (4 proteins) contains an all-alpha subdomain insertion |
Protein automated matches [190208] (8 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [186961] (1 PDB entry) |
Domain d2b3sb_: 2b3s B: [127795] automated match to d1a23__ mutant |
PDB Entry: 2b3s (more details), 1.96 Å
SCOPe Domain Sequences for d2b3sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b3sb_ c.47.1.13 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} qyedgkqyttlekpvagapqvleffsffcghayqfeevlhisdnvkkklpegvkmtkyhv nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee ydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyadt vkylsek
Timeline for d2b3sb_: