Lineage for d2b3ma1 (2b3m A:6-159)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721376Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 721377Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 721493Family d.38.1.4: MaoC-like [82636] (6 proteins)
  6. 721541Protein Hypothetical protein AF1124 [143171] (1 species)
  7. 721542Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [143172] (2 PDB entries)
  8. 721545Domain d2b3ma1: 2b3m A:6-159 [127791]

Details for d2b3ma1

PDB Entry: 2b3m (more details), 1.85 Å

PDB Description: Crystal structure of protein AF1124 from Archaeoglobus fulgidus
PDB Compounds: (A:) hypothetical protein AF1124

SCOP Domain Sequences for d2b3ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b3ma1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
vkmmslleemkgiyskkggkvkpfekfegelkegyrfeyekklceidvamfglisgdlnp
vhfdedfasktrfggrvvhgmlttslvsaavarlpgtvvlleqsfrytspvrigdvvrve
gvvsgveknrytidvkcytgdkvvaegvvkvliw

SCOP Domain Coordinates for d2b3ma1:

Click to download the PDB-style file with coordinates for d2b3ma1.
(The format of our PDB-style files is described here.)

Timeline for d2b3ma1: