SCOP 1.75: Domain d2b3jd1: 2b3j D:3-151

Lineage for d2b3jd1 (2b3j D:3-151)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (5 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (7 proteins)
   strand 5 is parallel to strand 4

6. Protein tRNA adenosine deaminase TadA [142840] (3 species)

7. Species Staphylococcus aureus [TaxId:1280] [142841] (1 PDB entry)
   Uniprot Q99W51 1-151

8. Domain d2b3jd1: 2b3j D:3-151 [127790]
   automatically matched to 2B3J A:1-151
   complexed with gol, pr5, zn

Details for d2b3jd1

PDB Entry: 2b3j, 2 Å

PDB Description: Crystal Structure of Staphylococcus aureus tRNA Adenosine Deaminase, TadA, in Complex with RNA

PDB Compounds: (D:) tRNA adenosine deaminase

SCOP Domain Sequences for d2b3jd1:

Sequence; same for both SEQRES and ATOM records:

>d2b3jd1 c.97.1.2 (D:3-151) tRNA adenosine deaminase TadA {Staphylococcus aureus [TaxId: 1280]}
ndiyfmtlaieeakkaaqlgevpigaiitkddeviarahnlretlqqptahaehiaiera
akvlgswrlegctlyvtlepcvmcagtivmsriprvvygaddpkggcsgslmnllqqsnf
nhraivdkgvlkeacstllttffknlran

Timeline for d2b3jd1:

• d2b3jd1 first appeared in SCOP 1.73
  
• d2b3jd1 is called d2b3jd_ in SCOPe 2.01
  
• d2b3jd1 appears in the current release, SCOPe 2.08, called d2b3jd_