SCOPe 2.06: Domain d2b3jb_: 2b3j B:

Lineage for d2b3jb_ (2b3j B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
   strand 5 is parallel to strand 4

6. Protein tRNA adenosine deaminase TadA [142840] (3 species)

7. Species Staphylococcus aureus [TaxId:1280] [142841] (1 PDB entry)
   Uniprot Q99W51 1-151

8. Domain d2b3jb_: 2b3j B: [127788]
   automated match to d2b3ja1
   protein/RNA complex; complexed with gol, zn

Details for d2b3jb_

PDB Entry: 2b3j, 2 Å

PDB Description: Crystal Structure of Staphylococcus aureus tRNA Adenosine Deaminase, TadA, in Complex with RNA

PDB Compounds: (B:) tRNA adenosine deaminase

SCOPe Domain Sequences for d2b3jb_:

Sequence; same for both SEQRES and ATOM records:

>d2b3jb_ c.97.1.2 (B:) tRNA adenosine deaminase TadA {Staphylococcus aureus [TaxId: 1280]}
mtndiyfmtlaieeakkaaqlgevpigaiitkddeviarahnlretlqqptahaehiaie
raakvlgswrlegctlyvtlepcvmcagtivmsriprvvygaddpkggcsgslmnllqqs
nfnhraivdkgvlkeacstllttffknlran

Timeline for d2b3jb_:

• d2b3jb_ first appeared in SCOP 1.73, called d2b3jb1
  
• d2b3jb_ appears in SCOPe 2.05
  
• d2b3jb_ appears in SCOPe 2.07
  
• d2b3jb_ appears in the current release, SCOPe 2.08