Lineage for d2b3jb_ (2b3j B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918566Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
    strand 5 is parallel to strand 4
  6. 2918643Protein tRNA adenosine deaminase TadA [142840] (3 species)
  7. 2918652Species Staphylococcus aureus [TaxId:1280] [142841] (1 PDB entry)
    Uniprot Q99W51 1-151
  8. 2918654Domain d2b3jb_: 2b3j B: [127788]
    automated match to d2b3ja1
    protein/RNA complex; complexed with gol, zn

Details for d2b3jb_

PDB Entry: 2b3j (more details), 2 Å

PDB Description: Crystal Structure of Staphylococcus aureus tRNA Adenosine Deaminase, TadA, in Complex with RNA
PDB Compounds: (B:) tRNA adenosine deaminase

SCOPe Domain Sequences for d2b3jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b3jb_ c.97.1.2 (B:) tRNA adenosine deaminase TadA {Staphylococcus aureus [TaxId: 1280]}
mtndiyfmtlaieeakkaaqlgevpigaiitkddeviarahnlretlqqptahaehiaie
raakvlgswrlegctlyvtlepcvmcagtivmsriprvvygaddpkggcsgslmnllqqs
nfnhraivdkgvlkeacstllttffknlran

SCOPe Domain Coordinates for d2b3jb_:

Click to download the PDB-style file with coordinates for d2b3jb_.
(The format of our PDB-style files is described here.)

Timeline for d2b3jb_: