Lineage for d2b3ga_ (2b3g A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2398969Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 2399161Protein automated matches [190206] (10 species)
    not a true protein
  7. 2399174Species Human (Homo sapiens) [TaxId:9606] [186959] (27 PDB entries)
  8. 2399185Domain d2b3ga_: 2b3g A: [127786]
    automated match to d1ewia_

Details for d2b3ga_

PDB Entry: 2b3g (more details), 1.6 Å

PDB Description: p53N (fragment 33-60) bound to RPA70N
PDB Compounds: (A:) Replication protein A 70 kDa DNA-binding subunit

SCOPe Domain Sequences for d2b3ga_:

Sequence, based on SEQRES records: (download)

>d2b3ga_ b.40.4.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvgqlsegaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmlat
qlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvpyne

Sequence, based on observed residues (ATOM records): (download)

>d2b3ga_ b.40.4.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvgqlsegaiaaimqkgdtnikpilqvinirpitsppryrllmsdglntlssfmlatqln
plveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvpyne

SCOPe Domain Coordinates for d2b3ga_:

Click to download the PDB-style file with coordinates for d2b3ga_.
(The format of our PDB-style files is described here.)

Timeline for d2b3ga_: