Lineage for d2b3ga1 (2b3g A:3-114)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668080Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 668156Protein Replication protein A 70 KDa subunit (RPA70) [50267] (1 species)
    duplication: consists of three domains of this fold; contains zinc-finger insert in the C-terminal domain, residues 479-511
  7. 668157Species Human (Homo sapiens) [TaxId:9606] [50268] (6 PDB entries)
  8. 668158Domain d2b3ga1: 2b3g A:3-114 [127786]
    automatically matched to d1ewia_

Details for d2b3ga1

PDB Entry: 2b3g (more details), 1.6 Å

PDB Description: p53N (fragment 33-60) bound to RPA70N
PDB Compounds: (A:) Replication protein A 70 kDa DNA-binding subunit

SCOP Domain Sequences for d2b3ga1:

Sequence, based on SEQRES records: (download)

>d2b3ga1 b.40.4.3 (A:3-114) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]}
gqlsegaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmlatql
nplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkign

Sequence, based on observed residues (ATOM records): (download)

>d2b3ga1 b.40.4.3 (A:3-114) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]}
gqlsegaiaaimqkgdtnikpilqvinirpitsppryrllmsdglntlssfmlatqlnpl
veeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkign

SCOP Domain Coordinates for d2b3ga1:

Click to download the PDB-style file with coordinates for d2b3ga1.
(The format of our PDB-style files is described here.)

Timeline for d2b3ga1: