SCOPe 2.08: Domain d2b3aa_: 2b3a A:

Lineage for d2b3aa_ (2b3a A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
   contains Pfam PF00788 and Pfam PF02196

6. Protein Ral guanosine-nucleotide exchange factor, RalGDS [54267] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54269] (3 PDB entries)

8. Domain d2b3aa_: 2b3a A: [127785]
   automated match to d1raxa_

Details for d2b3aa_

PDB Entry: 2b3a

PDB Description: solution structure of the ras-binding domain of the ral guanosine dissociation stimulator

PDB Compounds: (A:) Ral guanine nucleotide dissociation stimulator

SCOPe Domain Sequences for d2b3aa_:

Sequence; same for both SEQRES and ATOM records:

>d2b3aa_ d.15.1.5 (A:) Ral guanosine-nucleotide exchange factor, RalGDS {Human (Homo sapiens) [TaxId: 9606]}
dcciirvsldvdngnmyksilvtsqdkapavirkamdkhnleeeepedyellqilsddrk
lkipenanvfyamnstanydfvlkkrt

Timeline for d2b3aa_:

• d2b3aa_ first appeared in SCOP 1.73, called d2b3aa1
  
• d2b3aa_ appears in SCOPe 2.07