SCOP 1.73: Domain d2b37c1: 2b37 C:2-269

Lineage for d2b37c1 (2b37 C:2-269)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Enoyl-ACP reductase [51791] (6 species)

7. Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (19 PDB entries)

8. Domain d2b37c1: 2b37 C:2-269 [127781]
   automatically matched to d1bvra_
   complexed with 8ps, nad

Details for d2b37c1

PDB Entry: 2b37, 2.6 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis enoyl reductase (InhA) inhibited by 5-octyl-2-phenoxyphenol

PDB Compounds: (C:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOP Domain Sequences for d2b37c1:

Sequence, based on SEQRES records:

>d2b37c1 c.2.1.2 (C:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
vcallsdwlpattgdiiyadggahtqll

Sequence, based on observed residues (ATOM records):

>d2b37c1 c.2.1.2 (C:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtgalgeeagaqiqlleegwdqrapigwnmkdatpvaktvcallsdw
lpattgdiiyadggahtqll

Timeline for d2b37c1:

• d2b37c1 is new in SCOP 1.73
  
• d2b37c1 appears in SCOP 1.75
  
• d2b37c1 appears in the current release, SCOPe 2.08, called d2b37c_