Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein Enoyl-ACP reductase [51791] (6 species) |
Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (19 PDB entries) |
Domain d2b37c1: 2b37 C:2-269 [127781] automatically matched to d1bvra_ complexed with 8ps, nad |
PDB Entry: 2b37 (more details), 2.6 Å
SCOP Domain Sequences for d2b37c1:
Sequence, based on SEQRES records: (download)
>d2b37c1 c.2.1.2 (C:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt vcallsdwlpattgdiiyadggahtqll
>d2b37c1 c.2.1.2 (C:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk ygvrsnlvaagpirtgalgeeagaqiqlleegwdqrapigwnmkdatpvaktvcallsdw lpattgdiiyadggahtqll
Timeline for d2b37c1: