![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
![]() | Protein Enoyl-ACP reductase [51791] (11 species) |
![]() | Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (96 PDB entries) |
![]() | Domain d2b36d_: 2b36 D: [127776] automated match to d1bvra_ complexed with 5pp, nad |
PDB Entry: 2b36 (more details), 2.8 Å
SCOPe Domain Sequences for d2b36d_:
Sequence, based on SEQRES records: (download)
>d2b36d_ c.2.1.2 (D:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt vcallsdwlpattgdiiyadggahtqll
>d2b36d_ c.2.1.2 (D:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk ygvrsnlvaagpirtlamegwdqrapigwnmkdatpvaktvcallsdwlpattgdiiyad ggahtqll
Timeline for d2b36d_: