SCOP 1.73: Domain d2b33b1: 2b33 B:2-127

Lineage for d2b33b1 (2b33 B:2-127)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (2 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.1: YjgF/L-PSP [55299] (10 proteins)
   some members possess an endoribonuclease activity inhibiting mRNA translation

6. Protein Putative protein synthesis inhibitor TM0215 [143525] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [143526] (1 PDB entry)

8. Domain d2b33b1: 2b33 B:2-127 [127766]
   automatically matched to 2B33 A:2-127
   complexed with ca, edo

Details for d2b33b1

PDB Entry: 2b33, 2.3 Å

PDB Description: crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution

PDB Compounds: (B:) protein synthesis inhibitor, putative

SCOP Domain Sequences for d2b33b1:

Sequence; same for both SEQRES and ATOM records:

>d2b33b1 d.79.1.1 (B:2-127) Putative protein synthesis inhibitor TM0215 {Thermotoga maritima [TaxId: 2336]}
krfvetdkapkaigpysqavvvgnmmfvsgqipidpetgelvqgtieektervlenlkai
leaggfslkdvvkvtvfttsmdyfqrvnevysryfgdhrparsfvavaqlprnveieiea
iavkeg

Timeline for d2b33b1:

• d2b33b1 is new in SCOP 1.73
  
• d2b33b1 appears in SCOP 1.75
  
• d2b33b1 appears in the current release, SCOPe 2.08, called d2b33b_