Lineage for d2b31a1 (2b31 A:1-239,A:308-362)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2831708Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 2831895Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
    secreted during involution
  7. 2831909Species Goat (Capra hircus) [TaxId:9925] [89481] (14 PDB entries)
  8. 2831921Domain d2b31a1: 2b31 A:1-239,A:308-362 [127763]
    Other proteins in same PDB: d2b31a2
    automatically matched to d1ljya1

Details for d2b31a1

PDB Entry: 2b31 (more details), 3.1 Å

PDB Description: crystal structure of the complex formed between goat signalling protein with pentasaccharide at 3.1 a resolution reveals large scale conformational changes in the residues of tim barrel
PDB Compounds: (A:) Chitinase-3-like protein 1, SPG-40

SCOPe Domain Sequences for d2b31a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b31a1 c.1.8.5 (A:1-239,A:308-362) Signal processing protein (SPC-40, MGP-40) {Goat (Capra hircus) [TaxId: 9925]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpklktllsvggwnfgperfskiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhltalvkemkaefareaqagterlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgnsdassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlarv

SCOPe Domain Coordinates for d2b31a1:

Click to download the PDB-style file with coordinates for d2b31a1.
(The format of our PDB-style files is described here.)

Timeline for d2b31a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b31a2