Lineage for d2b30d1 (2b30 D:18-300)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712195Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 712196Superfamily c.108.1: HAD-like [56784] (23 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 712401Family c.108.1.10: Predicted hydrolases Cof [82388] (11 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 712414Protein PFL1270w orthologue [142165] (1 species)
  7. 712415Species Plasmodium vivax [TaxId:5855] [142166] (1 PDB entry)
  8. 712419Domain d2b30d1: 2b30 D:18-300 [127762]
    automatically matched to 2B30 A:18-300
    complexed with ca, cl

Details for d2b30d1

PDB Entry: 2b30 (more details), 2.7 Å

PDB Description: Initial Crystallographic Structural Analysis of a putative HAD/COF-like hydrolase from Plasmodium vivax
PDB Compounds: (D:) Pvivax hypothetical protein

SCOP Domain Sequences for d2b30d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b30d1 c.108.1.10 (D:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]}
veealkgadiklllidfdgtlfvdkdikvpsenidaikeaiekgymvsictgrskvgils
afgeenlkkmnfygmpgvyingtivydqigytlldetietdvyaelisylveknlvnqti
fhrgesnyvtednkyadflqkmysenrsiiirhnemlkyrtmnklmivldpsesktvign
lkqkfknkltifttynghaevtklghdkytginyllkhynisndqvlvvgdaendiamls
nfkysfavanatdsakshakcvlpvshregavayllkkvfdlk

SCOP Domain Coordinates for d2b30d1:

Click to download the PDB-style file with coordinates for d2b30d1.
(The format of our PDB-style files is described here.)

Timeline for d2b30d1: