SCOPe 2.06: Domain d2b30c_: 2b30 C:

Lineage for d2b30c_ (2b30 C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein automated matches [190498] (5 species)
   not a true protein

7. Species Plasmodium vivax [TaxId:5855] [187442] (1 PDB entry)

8. Domain d2b30c_: 2b30 C: [127761]
   Other proteins in same PDB: d2b30a1
   automated match to d2b30a1
   complexed with ca, cl

Details for d2b30c_

PDB Entry: 2b30, 2.7 Å

PDB Description: Initial Crystallographic Structural Analysis of a putative HAD/COF-like hydrolase from Plasmodium vivax

PDB Compounds: (C:) Pvivax hypothetical protein

SCOPe Domain Sequences for d2b30c_:

Sequence; same for both SEQRES and ATOM records:

>d2b30c_ c.108.1.10 (C:) automated matches {Plasmodium vivax [TaxId: 5855]}
kveealkgadiklllidfdgtlfvdkdikvpsenidaikeaiekgymvsictgrskvgil
safgeenlkkmnfygmpgvyingtivydqigytlldetietdvyaelisylveknlvnqt
ifhrgesnyvtednkyadflqkmysenrsiiirhnemlkyrtmnklmivldpsesktvig
nlkqkfknkltifttynghaevtklghdkytginyllkhynisndqvlvvgdaendiaml
snfkysfavanatdsakshakcvlpvshregavayllkkvfdlk

Timeline for d2b30c_:

• d2b30c_ first appeared in SCOP 1.73, called d2b30c1
  
• d2b30c_ appears in SCOPe 2.05
  
• d2b30c_ appears in SCOPe 2.07
  
• d2b30c_ appears in the current release, SCOPe 2.08