Lineage for d2b30c_ (2b30 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919946Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 2920018Protein automated matches [190498] (5 species)
    not a true protein
  7. 2920024Species Plasmodium vivax [TaxId:5855] [187442] (1 PDB entry)
  8. 2920026Domain d2b30c_: 2b30 C: [127761]
    Other proteins in same PDB: d2b30a1
    automated match to d2b30a1
    complexed with ca, cl

Details for d2b30c_

PDB Entry: 2b30 (more details), 2.7 Å

PDB Description: Initial Crystallographic Structural Analysis of a putative HAD/COF-like hydrolase from Plasmodium vivax
PDB Compounds: (C:) Pvivax hypothetical protein

SCOPe Domain Sequences for d2b30c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b30c_ c.108.1.10 (C:) automated matches {Plasmodium vivax [TaxId: 5855]}
kveealkgadiklllidfdgtlfvdkdikvpsenidaikeaiekgymvsictgrskvgil
safgeenlkkmnfygmpgvyingtivydqigytlldetietdvyaelisylveknlvnqt
ifhrgesnyvtednkyadflqkmysenrsiiirhnemlkyrtmnklmivldpsesktvig
nlkqkfknkltifttynghaevtklghdkytginyllkhynisndqvlvvgdaendiaml
snfkysfavanatdsakshakcvlpvshregavayllkkvfdlk

SCOPe Domain Coordinates for d2b30c_:

Click to download the PDB-style file with coordinates for d2b30c_.
(The format of our PDB-style files is described here.)

Timeline for d2b30c_: