SCOP 1.73: Domain d2b30a1: 2b30 A:18-300

Lineage for d2b30a1 (2b30 A:18-300)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (23 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (11 proteins)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein PFL1270w orthologue [142165] (1 species)

7. Species Plasmodium vivax [TaxId:5855] [142166] (1 PDB entry)

8. Domain d2b30a1: 2b30 A:18-300 [127759]
   complexed with ca, cl

Details for d2b30a1

PDB Entry: 2b30, 2.7 Å

PDB Description: Initial Crystallographic Structural Analysis of a putative HAD/COF-like hydrolase from Plasmodium vivax

PDB Compounds: (A:) Pvivax hypothetical protein

SCOP Domain Sequences for d2b30a1:

Sequence; same for both SEQRES and ATOM records:

>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]}
veealkgadiklllidfdgtlfvdkdikvpsenidaikeaiekgymvsictgrskvgils
afgeenlkkmnfygmpgvyingtivydqigytlldetietdvyaelisylveknlvnqti
fhrgesnyvtednkyadflqkmysenrsiiirhnemlkyrtmnklmivldpsesktvign
lkqkfknkltifttynghaevtklghdkytginyllkhynisndqvlvvgdaendiamls
nfkysfavanatdsakshakcvlpvshregavayllkkvfdlk

Timeline for d2b30a1:

• d2b30a1 is new in SCOP 1.73
  
• d2b30a1 appears in SCOP 1.75
  
• d2b30a1 appears in the current release, SCOPe 2.08