Lineage for d2b2ya2 (2b2y A:13-107)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 797173Superfamily b.34.13: Chromo domain-like [54160] (3 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 797197Family b.34.13.2: Chromo domain [54165] (7 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 797198Protein ATP-dependent helicase CHD1 (Chromo domain protein 1) [141220] (2 species)
  7. 797202Species Human (Homo sapiens) [TaxId:9606] [141221] (5 PDB entries)
    Uniprot O14646 269-366! Uniprot O14646 270-355! Uniprot O14646 366-445! Uniprot O14646 367-443! Uniprot O14646 367-445
  8. 797204Domain d2b2ya2: 2b2y A:13-107 [127755]
    automatically matched to 2B2U A:13-107

Details for d2b2ya2

PDB Entry: 2b2y (more details), 2.35 Å

PDB Description: tandem chromodomains of human chd1
PDB Compounds: (A:) Chromodomain-helicase-DNA-binding protein 1

SCOP Domain Sequences for d2b2ya2:

Sequence, based on SEQRES records: (download)

>d2b2ya2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]}
fetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqylikwkgwshihn
tweteetlkqqnvrgmkkldnykkkdqetkrwlkn

Sequence, based on observed residues (ATOM records): (download)

>d2b2ya2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]}
fetierfmdcrigrkgatgatttiyaveadgdpnagfenkepgeiqylikwkgwshihnt
weteetlkqqnvrgmkkldnykkkdqetkrwlkn

SCOP Domain Coordinates for d2b2ya2:

Click to download the PDB-style file with coordinates for d2b2ya2.
(The format of our PDB-style files is described here.)

Timeline for d2b2ya2: