Lineage for d2b2xm1 (2b2x M:2-106)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 783142Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (44 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 783151Domain d2b2xm1: 2b2x M:2-106 [127752]
    Other proteins in same PDB: d2b2xa1, d2b2xb1, d2b2xl2, d2b2xm2
    automatically matched to d1dqdl1
    complexed with mg; mutant

Details for d2b2xm1

PDB Entry: 2b2x (more details), 2.2 Å

PDB Description: vla1 rdeltah i-domain complexed with a quadruple mutant of the aqc2 fab
PDB Compounds: (M:) Antibody AQC2 Fab

SCOP Domain Sequences for d2b2xm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b2xm1 b.1.1.1 (M:2-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
iqltqspsslsasvgdrvtitcsassqvnhmfwyqqkpgkapkpwiyltsylasgvpsrf
sgsgsgtdytltisslqpedfatyycqqwsgnpwtfgqgtkveik

SCOP Domain Coordinates for d2b2xm1:

Click to download the PDB-style file with coordinates for d2b2xm1.
(The format of our PDB-style files is described here.)

Timeline for d2b2xm1: