![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
![]() | Family b.34.13.2: Chromo domain [54165] (8 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
![]() | Protein ATP-dependent helicase CHD1 (Chromo domain protein 1) [141220] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141221] (5 PDB entries) Uniprot O14646 269-366! Uniprot O14646 270-355! Uniprot O14646 366-445! Uniprot O14646 367-443! Uniprot O14646 367-445 |
![]() | Domain d2b2vc1: 2b2v C:13-97 [127742] Other proteins in same PDB: d2b2va3 automatically matched to 2B2T C:12-97 |
PDB Entry: 2b2v (more details), 2.65 Å
SCOPe Domain Sequences for d2b2vc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b2vc1 b.34.13.2 (C:13-97) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} fetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqylikwkgwshihn tweteetlkqqnvrgmkkldnykkk
Timeline for d2b2vc1: