SCOP 1.73: Domain d2b2vb2: 2b2v B:13-107

Lineage for d2b2vb2 (2b2v B:13-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (3 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (7 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein ATP-dependent helicase CHD1 (Chromo domain protein 1) [141220] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141221] (5 PDB entries)

8. Domain d2b2vb2: 2b2v B:13-107 [127741]
   automatically matched to 2B2U A:13-107
   complexed with mlz

Details for d2b2vb2

PDB Entry: 2b2v, 2.65 Å

PDB Description: crystal structure analysis of human chd1 chromodomains 1 and 2 bound to histone h3 resi 1-15 mek4

PDB Compounds: (B:) Chromodomain-helicase-DNA-binding protein 1

SCOP Domain Sequences for d2b2vb2:

Sequence; same for both SEQRES and ATOM records:

>d2b2vb2 b.34.13.2 (B:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]}
fetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqylikwkgwshihn
tweteetlkqqnvrgmkkldnykkkdqetkrwlkn

Timeline for d2b2vb2:

• d2b2vb2 is new in SCOP 1.73
  
• d2b2vb2 appears in SCOP 1.75
  
• d2b2vb2 appears in the current release, SCOPe 2.08