Class b: All beta proteins [48724] (165 folds) |
Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (3 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.2: Chromo domain [54165] (7 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
Protein ATP-dependent helicase CHD1 (Chromo domain protein 1) [141220] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [141221] (5 PDB entries) |
Domain d2b2va1: 2b2v A:108-186 [127738] automatically matched to 2B2U A:108-187 complexed with mlz |
PDB Entry: 2b2v (more details), 2.65 Å
SCOP Domain Sequences for d2b2va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b2va1 b.34.13.2 (A:108-186) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} aspedveyyncqqeltddlhkqyqivgriiahsnqksaagypdyyckwqglpysecswed galiskkfqacideyfsrk
Timeline for d2b2va1: