Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.2: Chromo domain [54165] (8 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
Protein ATP-dependent helicase CHD1 (Chromo domain protein 1) [141220] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [141221] (5 PDB entries) Uniprot O14646 269-366! Uniprot O14646 270-355! Uniprot O14646 366-445! Uniprot O14646 367-443! Uniprot O14646 367-445 |
Domain d2b2ub1: 2b2u B:108-185 [127735] Other proteins in same PDB: d2b2ua3 automatically matched to 2B2U A:108-187 |
PDB Entry: 2b2u (more details), 2.95 Å
SCOPe Domain Sequences for d2b2ub1:
Sequence, based on SEQRES records: (download)
>d2b2ub1 b.34.13.2 (B:108-185) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} aspedveyyncqqeltddlhkqyqivgriiahsnqksaagypdyyckwqglpysecswed galiskkfqacideyfsr
>d2b2ub1 b.34.13.2 (B:108-185) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} aspedveyyncqqeltddlhkqyqivgriiahsnqkagypdyyckwqglpysecswedga liskkfqacideyfsr
Timeline for d2b2ub1:
View in 3D Domains from other chains: (mouse over for more information) d2b2ua1, d2b2ua2, d2b2ua3, d2b2uc1 |