SCOPe 2.01: Domain d2b2ua2: 2b2u A:13-107

Lineage for d2b2ua2 (2b2u A:13-107)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein ATP-dependent helicase CHD1 (Chromo domain protein 1) [141220] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141221] (5 PDB entries)
   Uniprot O14646 269-366! Uniprot O14646 270-355! Uniprot O14646 366-445! Uniprot O14646 367-443! Uniprot O14646 367-445

8. Domain d2b2ua2: 2b2u A:13-107 [127734]

Details for d2b2ua2

PDB Entry: 2b2u, 2.95 Å

PDB Description: tandem chromodomains of human chd1 complexed with histone h3 tail containing trimethyllysine 4 and dimethylarginine 2

PDB Compounds: (A:) Chromodomain-helicase-DNA-binding protein 1

SCOPe Domain Sequences for d2b2ua2:

Sequence, based on SEQRES records:

>d2b2ua2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]}
fetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqylikwkgwshihn
tweteetlkqqnvrgmkkldnykkkdqetkrwlkn

Sequence, based on observed residues (ATOM records):

>d2b2ua2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]}
fetierfmdcrigrkgatgatttiyaveadgdpnagfekepgeiqylikwkgwshihntw
eteetlkqqnvrgmkkldnykkkdqetkrwlkn

Timeline for d2b2ua2:

• d2b2ua2 first appeared in SCOP 1.73
  
• d2b2ua2 appears in SCOP 1.75
  
• d2b2ua2 appears in SCOPe 2.02
  
• d2b2ua2 appears in the current release, SCOPe 2.08