Lineage for d2b2ua2 (2b2u A:13-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785079Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 2785080Protein ATP-dependent helicase CHD1 (Chromo domain protein 1) [141220] (2 species)
  7. 2785084Species Human (Homo sapiens) [TaxId:9606] [141221] (5 PDB entries)
    Uniprot O14646 269-366! Uniprot O14646 270-355! Uniprot O14646 366-445! Uniprot O14646 367-443! Uniprot O14646 367-445
  8. 2785106Domain d2b2ua2: 2b2u A:13-107 [127734]
    Other proteins in same PDB: d2b2ua3

Details for d2b2ua2

PDB Entry: 2b2u (more details), 2.95 Å

PDB Description: tandem chromodomains of human chd1 complexed with histone h3 tail containing trimethyllysine 4 and dimethylarginine 2
PDB Compounds: (A:) Chromodomain-helicase-DNA-binding protein 1

SCOPe Domain Sequences for d2b2ua2:

Sequence, based on SEQRES records: (download)

>d2b2ua2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]}
fetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqylikwkgwshihn
tweteetlkqqnvrgmkkldnykkkdqetkrwlkn

Sequence, based on observed residues (ATOM records): (download)

>d2b2ua2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]}
fetierfmdcrigrkgatgatttiyaveadgdpnagfekepgeiqylikwkgwshihntw
eteetlkqqnvrgmkkldnykkkdqetkrwlkn

SCOPe Domain Coordinates for d2b2ua2:

Click to download the PDB-style file with coordinates for d2b2ua2.
(The format of our PDB-style files is described here.)

Timeline for d2b2ua2: