SCOPe 2.03: Domain d2b2sb1: 2b2s B:35-440

Lineage for d2b2sb1 (2b2s B:35-440)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 proteins)
   duplication: tandem repeat of two CCP-like domains

6. Protein Catalase-peroxidase KatG [74754] (4 species)
   only the N-terminal CCP-like domain binds heme

7. Species Burkholderia pseudomallei [TaxId:28450] [89093] (20 PDB entries)
   Uniprot P13029 Q939D2 35-748

8. Domain d2b2sb1: 2b2s B:35-440 [127726]
   automated match to d1mwva1
   complexed with hem, na, o

Details for d2b2sb1

PDB Entry: 2b2s, 2 Å

PDB Description: crystal structure of an oxoferryl species of catalase-peroxidase katg at ph7.5

PDB Compounds: (B:) Catalase-peroxidase

SCOPe Domain Sequences for d2b2sb1:

Sequence; same for both SEQRES and ATOM records:

>d2b2sb1 a.93.1.3 (B:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]}
ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwp
ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttp
tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevp

Timeline for d2b2sb1:

• d2b2sb1 first appeared in SCOP 1.73
  
• d2b2sb1 appears in SCOPe 2.02
  
• d2b2sb1 appears in SCOPe 2.04
  
• d2b2sb1 last appears in SCOPe 2.06