SCOP 1.73: Domain d2b2nb1: 2b2n B:26-333

Lineage for d2b2nb1 (2b2n B:26-333)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (22 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Transcription-repair coupling factor, TRCF [142320] (1 species)
   similar to UvrB in the N-terminal part and DEAD helicases in the C-terminal part; also contains CarD-like domain in the middle and TRCF domain at the C-terminus

7. Species Escherichia coli [TaxId:562] [142321] (2 PDB entries)

8. Domain d2b2nb1: 2b2n B:26-333 [127711]
   automatically matched to 2B2N A:26-333
   complexed with na, p4c, so4

Details for d2b2nb1

PDB Entry: 2b2n, 2.1 Å

PDB Description: structure of transcription-repair coupling factor

PDB Compounds: (B:) Transcription-repair coupling factor

SCOP Domain Sequences for d2b2nb1:

Sequence; same for both SEQRES and ATOM records:

>d2b2nb1 c.37.1.19 (B:26-333) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}
acatlvaeiaerhagpvvliapdmqnalrlhdeisqftdqmvmnladwetlpydsfsphq
diissrlstlyqlptmqrgvlivpvntlmqrvcphsflhghalvmkkgqrlsrdalrtql
dsagyrhvdqvmehgeyatrgalldlfpmgselpyrldffddeidslrvfdvdsqrtlee
veainllpahefptdkaaielfrsqwrdtfevkrdpehiyqqvskgtlpagieywqplff
seplpplfsyfpantllvntgdletsaerfqadtlarfenrgvdpmrpllppqslwlrvd
elfselkn

Timeline for d2b2nb1:

• d2b2nb1 is new in SCOP 1.73
  
• d2b2nb1 appears in SCOP 1.75
  
• d2b2nb1 appears in the current release, SCOPe 2.08, called d2b2nb2