SCOPe 2.06: Domain d2b2na1: 2b2n A:26-333

Lineage for d2b2na1 (2b2n A:26-333)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Transcription-repair coupling factor, TRCF [142320] (1 species)
   similar to UvrB in the N-terminal part and DEAD helicases in the C-terminal part; also contains CarD-like domain in the middle and TRCF domain at the C-terminus

7. Species Escherichia coli [TaxId:562] [142321] (2 PDB entries)
   Uniprot P30958 2-348! Uniprot P30958 26-333! Uniprot P30958 349-465! Uniprot P30958 546-778! Uniprot P30958 779-989

8. Domain d2b2na1: 2b2n A:26-333 [127710]
   Other proteins in same PDB: d2b2nb3
   N-terminal domain only
   complexed with na, p4c, so4

Details for d2b2na1

PDB Entry: 2b2n, 2.1 Å

PDB Description: structure of transcription-repair coupling factor

PDB Compounds: (A:) Transcription-repair coupling factor

SCOPe Domain Sequences for d2b2na1:

Sequence; same for both SEQRES and ATOM records:

>d2b2na1 c.37.1.19 (A:26-333) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}
acatlvaeiaerhagpvvliapdmqnalrlhdeisqftdqmvmnladwetlpydsfsphq
diissrlstlyqlptmqrgvlivpvntlmqrvcphsflhghalvmkkgqrlsrdalrtql
dsagyrhvdqvmehgeyatrgalldlfpmgselpyrldffddeidslrvfdvdsqrtlee
veainllpahefptdkaaielfrsqwrdtfevkrdpehiyqqvskgtlpagieywqplff
seplpplfsyfpantllvntgdletsaerfqadtlarfenrgvdpmrpllppqslwlrvd
elfselkn

Timeline for d2b2na1:

• d2b2na1 first appeared in SCOP 1.73
  
• d2b2na1 appears in SCOPe 2.05
  
• d2b2na1 appears in SCOPe 2.07
  
• d2b2na1 appears in the current release, SCOPe 2.08