| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.19: Tandem AAA-ATPase domain [81268] (22 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
| Protein Transcription-repair coupling factor, TRCF [142320] (1 species) similar to UvrB in the N-terminal part and DEAD helicases in the C-terminal part; also contains CarD-like domain in the middle and TRCF domain at the C-terminus |
| Species Escherichia coli [TaxId:562] [142321] (2 PDB entries) |
| Domain d2b2na1: 2b2n A:26-333 [127710] N-terminal domain only complexed with na, p4c, so4 |
PDB Entry: 2b2n (more details), 2.1 Å
SCOP Domain Sequences for d2b2na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b2na1 c.37.1.19 (A:26-333) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}
acatlvaeiaerhagpvvliapdmqnalrlhdeisqftdqmvmnladwetlpydsfsphq
diissrlstlyqlptmqrgvlivpvntlmqrvcphsflhghalvmkkgqrlsrdalrtql
dsagyrhvdqvmehgeyatrgalldlfpmgselpyrldffddeidslrvfdvdsqrtlee
veainllpahefptdkaaielfrsqwrdtfevkrdpehiyqqvskgtlpagieywqplff
seplpplfsyfpantllvntgdletsaerfqadtlarfenrgvdpmrpllppqslwlrvd
elfselkn
Timeline for d2b2na1: