Lineage for d2b2na1 (2b2n A:26-333)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 697477Family c.37.1.19: Tandem AAA-ATPase domain [81268] (22 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 697635Protein Transcription-repair coupling factor, TRCF [142320] (1 species)
    similar to UvrB in the N-terminal part and DEAD helicases in the C-terminal part; also contains CarD-like domain in the middle and TRCF domain at the C-terminus
  7. 697636Species Escherichia coli [TaxId:562] [142321] (2 PDB entries)
  8. 697637Domain d2b2na1: 2b2n A:26-333 [127710]
    N-terminal domain only
    complexed with na, p4c, so4

Details for d2b2na1

PDB Entry: 2b2n (more details), 2.1 Å

PDB Description: structure of transcription-repair coupling factor
PDB Compounds: (A:) Transcription-repair coupling factor

SCOP Domain Sequences for d2b2na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b2na1 c.37.1.19 (A:26-333) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}
acatlvaeiaerhagpvvliapdmqnalrlhdeisqftdqmvmnladwetlpydsfsphq
diissrlstlyqlptmqrgvlivpvntlmqrvcphsflhghalvmkkgqrlsrdalrtql
dsagyrhvdqvmehgeyatrgalldlfpmgselpyrldffddeidslrvfdvdsqrtlee
veainllpahefptdkaaielfrsqwrdtfevkrdpehiyqqvskgtlpagieywqplff
seplpplfsyfpantllvntgdletsaerfqadtlarfenrgvdpmrpllppqslwlrvd
elfselkn

SCOP Domain Coordinates for d2b2na1:

Click to download the PDB-style file with coordinates for d2b2na1.
(The format of our PDB-style files is described here.)

Timeline for d2b2na1: