Lineage for d2b2kb2 (2b2k B:4-182)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971664Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)
  6. 2971711Protein automated matches [190207] (2 species)
    not a true protein
  7. 2971715Species Escherichia coli [TaxId:562] [186960] (3 PDB entries)
  8. 2971717Domain d2b2kb2: 2b2k B:4-182 [127709]
    Other proteins in same PDB: d2b2kb3
    automated match to d1nfsb_
    complexed with eip, mg, mn; mutant

Details for d2b2kb2

PDB Entry: 2b2k (more details), 1.97 Å

PDB Description: structure of y104f idi-1 mutant in complex with eipp
PDB Compounds: (B:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d2b2kb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b2kb2 d.113.1.2 (B:4-182) automated matches {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfrfratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlk

SCOPe Domain Coordinates for d2b2kb2:

Click to download the PDB-style file with coordinates for d2b2kb2.
(The format of our PDB-style files is described here.)

Timeline for d2b2kb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b2kb3
View in 3D
Domains from other chains:
(mouse over for more information)
d2b2ka_