Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins) barrel, closed; n=5, S=10 |
Protein automated matches [190206] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186959] (27 PDB entries) |
Domain d2b29a_: 2b29 A: [127705] automated match to d1ewia_ |
PDB Entry: 2b29 (more details), 1.6 Å
SCOPe Domain Sequences for d2b29a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b29a_ b.40.4.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gqlsegaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmlatql nplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvpyne
Timeline for d2b29a_: